PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR10G12950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24145.5 Da    PI: 10.2487
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR10G12950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF946.9e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++g+lye++s
  LPERR10G12950.1  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 59
                     79***********************************************86 PP

2K-box49.12.4e-1779162689
            K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                      ++++ +++ ++ + +   L +++e L  + R++lGe+Les s++eL+ Le +Leksl +iR kK++ ll+  e+l+ k ++l+ 
  LPERR10G12950.1  79 NNKTIQQDIQQVKDDTLDLARKLEALDDSRRKMLGENLESSSIEELRGLEIKLEKSLHNIRLKKERTLLKDNENLRGKHRNLEA 162
                      44577888999**********************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-31385IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002657.81E-41379No hitNo description
PRINTSPR004041.0E-30323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-303859IPR002100Transcription factor, MADS-box
PfamPF014866.3E-1684162IPR002487Transcription factor, K-box
PROSITE profilePS5129710.70187171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MVRGRTELKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGRLYEFASA  60
PSLQKTIDRY KAYTKDHVNN KTIQQDIQQV KDDTLDLARK LEALDDSRRK MLGENLESSS  120
IEELRGLEIK LEKSLHNIRL KKERTLLKDN ENLRGKHRNL EAAALVANRM TATPAWPRDV  180
TATSSKADAM DVETELSIGL PGTERSSSRP EKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-18177176Myocyte-specific enhancer factor 2B
1tqe_Q5e-18177176Myocyte-specific enhancer factor 2B
1tqe_R5e-18177176Myocyte-specific enhancer factor 2B
1tqe_S5e-18177176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614799.11e-131PREDICTED: MADS-box transcription factor 56
SwissprotA2Z9Q71e-134MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLA0A0D9XLW71e-155A0A0D9XLW7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA033356-PA1e-132(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.14e-61AGAMOUS-like 19